Uso del producto: Este producto está destinado exclusivamente a la investigación.
Toda la información de los productos de este sitio web tiene fines exclusivamente educativos. Cualquier forma de introducción en el cuerpo de personas o animales está estrictamente prohibida por la ley. Este producto solo debe ser manipulado por profesionales autorizados y cualificados. No es un medicamento, alimento ni cosmético y no debe etiquetarse, utilizarse ni presentarse como tal.
6mg in a Vial
Durante el cambio de envase, puedes recibir productos con la etiqueta anterior o con la nueva. La formulación, la pureza y la calidad siguen siendo exactamente las mismas, según nuestros estándares.
-25% en todo – hasta el 31 de octubre
25% sobre los precios habituales, en sustitución de otras ofertas. Acumulable solo con el descuento crypto.
Envío en el día para pedidos en EE. UU. realizados antes de las 12:00 EST.
Ver la política de envíos →Devoluciones sin complicaciones en 30 días para productos sin abrir.
Ver la política de devoluciones →Cada lote se analiza para comprobar su pureza, potencia y calidad.
Ver resultados de laboratorio →6mg in a Vial
| CAS Number | 154947-66-7 |
|---|---|
| Appearance | Lyophilized Powder |
| Chemical Names | CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536 |
| Molecular Formula | C205H340N60O53 |
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493 g/mol |
Never received my order. Contacted support and explained the situation and seemed to be helpful initially until I never received my tracking numbers! Followed it up with them and they have been unresponsive. Finally received a response with tracking numbers and hopefully it will be a seamless transaction moving forwards.
Wow Oder came as planned, I was able track it the entire way and made me feel comfortable about my order!
i am extremely happy with the delivery rate and the product!
The research results have been great so far. Super happy with the ordering process and purity is outstanding. Thanks for the outstanding support!
Highly consistent test results. First-class experience with the ordering process and purity is outstanding. I will definitely be back.
Outstanding experience with the ordering process and purity exceeded my expectations. Our research results are completely exceeding expectations. Great value.
We got fantastic research results. Cannot recommend enough the fast turnaround times, the compound is pure and high quality. Highly recommend this vendor.
